HORDB

ID: hor006415
Uniprot ID: P24259
Protein name: Cardiodilatin-related peptide
Gene name: NPPA
Organism: Sus scrofa (Pig)
Family: Natriuretic peptide family
Source: Animal
Expression: [Atrial natriuretic peptide]: Brain (at protein level).
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051427 hormone receptor binding
GO BP: GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0019934 cGMP-mediated signaling; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0042995 cell projection; GO:0043204 perikaryon

Sequence: NPVYGSVSNADLMDFKNLLDHLEDKMPLED
Length: 30(25-54)
Propeptide: MSSFTITVSFLLVLVFQFPGQTRANPVYGSVSNADLMDFKNLLDHLEDKMPLEDEAMPPQVLSEQNEEVGAPLSPLLEVPPWTGEVNPAQRDGGALGRGPWDASDRSALLKSKLRALLAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Signal peptide: MSSFTITVSFLLVLVFQFPGQTRA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP,
Mechanism: NA
Cross BBB: NA
Target: NPR1, NPR3
Target Unid: F1SFW3, A0A287ALM6
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006415_AF2.pdb

hor006415_ESM.pdb

Mass:	393828	Formula:	C149H231N37O51S2
Absent amino acids:	CIQRTW	Common amino acids:	DL
pI:	3.91	Basic residues:	3
Polar residues:	7	Hydrophobic residues:	9
Hydrophobicity:	-55.67	Boman Index:	-5673
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	87.67
Instability Index:	3495.33	Extinction Coefficient cystines:	1490
Absorbance 280nm:	51.38

PubMed ID: 2147477
Title: Nucleotide sequence of a porcine prepro atrial natriuretic peptide (ANP) cDNA.
PubMed ID: 6549270
Title: The auricular myocardiocytes of the heart constitute an endocrine organ. Characterization of a porcine cardiac peptide hormone, cardiodilatin-126.
PubMed ID: 6689515
Title: The right auricle of the he
PubMed ID: 2964562
Title: